SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008232 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000008232
Domain Number - Region: 42-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000131
Family Elafin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008232   Gene: ENSNLEG00000006763   Transcript: ENSNLET00000008621
Sequence length 93
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9499485:9507404:1 gene:ENSNLEG00000006763 transcript:ENSNLET00000008621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISEPENCTHLCTMQEDCEKGFQ
CCSSFCGIVCSSETFQKRNRNKHKGSEVIMPAN
Download sequence
Identical sequences ENSNLEP00000008232 ENSNLEP00000008232 XP_003253698.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]