SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008234 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008234
Domain Number 1 Region: 33-93
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008234   Gene: ENSNLEG00000006766   Transcript: ENSNLET00000008623
Sequence length 98
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9531083:9534518:1 gene:ENSNLEG00000006766 transcript:ENSNLET00000008623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYN
RTSKRCETFVFSGCNGNLNNFKLKIECEVACVAKYKPP
Download sequence
Identical sequences ENSNLEP00000008234 ENSNLEP00000008234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]