SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008239 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008239
Domain Number 1 Region: 168-207
Classification Level Classification E-value
Superfamily Elafin-like 0.000000196
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 75-114
Classification Level Classification E-value
Superfamily Elafin-like 0.000000641
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 123-159
Classification Level Classification E-value
Superfamily Elafin-like 0.000000719
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 4 Region: 26-67
Classification Level Classification E-value
Superfamily Elafin-like 0.0000432
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008239   Gene: ENSNLEG00000006768   Transcript: ENSNLET00000008628
Sequence length 231
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9578829:9598139:-1 gene:ENSNLEG00000006768 transcript:ENSNLET00000008628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSCLFLLKALLALGSLESWITAGEHAKEGECSPDKNPCKELCQGDELCLAGQKCCTTG
CGRICRDIPKGRKRDCPSVIRKQFCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLA
EFGGECPADPLPCEELCDGDASCPQGHKCCSTGCGRTCLGDIEGGWGGDCPKVLVGLCIV
GCVMDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
Download sequence
Identical sequences G1R4W7
ENSNLEP00000008239 ENSNLEP00000008239 XP_003253702.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]