SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008242 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008242
Domain Number 1 Region: 20-113
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.33e-41
Family MHC antigen-recognition domain 0.00000424
Further Details:      
 
Domain Number 2 Region: 111-209
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-26
Family C1 set domains (antibody constant domain-like) 0.00000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008242   Gene: ENSNLEG00000006770   Transcript: ENSNLET00000008631
Sequence length 263
Comment pep:novel supercontig:Nleu1.0:GL397342.1:9736669:9744549:-1 gene:ENSNLEG00000006770 transcript:ENSNLET00000008631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNGLANGLSNYLNQQDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPADVTITWRKNGKLVSPHSSAHKTARPNGDWTYQTLSYL
ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGLISW
RRAGSSSYTPLPGSNYPEGRHIS
Download sequence
Identical sequences G1R4X0
ENSNLEP00000008242 ENSNLEP00000008242 XP_003272208.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]