SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008271 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008271
Domain Number 1 Region: 29-112
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.54e-25
Family MHC antigen-recognition domain 0.0001
Further Details:      
 
Domain Number 2 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-23
Family C1 set domains (antibody constant domain-like) 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008271   Gene: ENSNLEG00000006793   Transcript: ENSNLET00000008661
Sequence length 250
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9811096:9815664:-1 gene:ENSNLEG00000006793 transcript:ENSNLET00000008661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRAGLVLGFHTLMTLLSPKEAGATKADHVGSYGPAFYQSYGASGQFTHEFDGEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLACIPAITAHLDVLVERSNRSRAISVPPRVTVLPK
SRVELDQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKLHYLPFV
PSAEDVYDCQVEPWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSAPR
Download sequence
Identical sequences ENSNLEP00000008271 ENSNLEP00000008271 XP_003272210.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]