SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008280 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008280
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.28e-37
Family MHC antigen-recognition domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 120-216
Classification Level Classification E-value
Superfamily Immunoglobulin 7.14e-28
Family C1 set domains (antibody constant domain-like) 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008280   Gene: ENSNLEG00000006801   Transcript: ENSNLET00000008671
Sequence length 258
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9889582:9900078:1 gene:ENSNLEG00000006801 transcript:ENSNLET00000008671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLYQVRQECYAFNGTQRYLERYIYN
REEVLRFDSDVGEFQAVTELGRPEAEYFNSQEDILEKKRAVTDTMCRHNYELDEAVTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHPSLDSPVTVDWKAQSDSARSKTLTGAGGFMLGLIIC
GVGIFMHRRSKKVQRGSA
Download sequence
Identical sequences G1R508
ENSNLEP00000008280 XP_003272211.1.23891 ENSNLEP00000008280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]