SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008291 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008291
Domain Number 1 Region: 347-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 982-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 3 Region: 827-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 5 Region: 522-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 873-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 283-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 8 Region: 470-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1034-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 10 Region: 435-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 11 Region: 1139-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 12 Region: 1091-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008291
Domain Number - Region: 1574-1778
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008291   Gene: ENSNLEG00000006812   Transcript: ENSNLET00000008682
Sequence length 1794
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:37357437:37369518:-1 gene:ENSNLEG00000006812 transcript:ENSNLET00000008682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPRRHWDDVVCESRYSEIEPSSEGEVIYRVLDPAIPIPDPYSSQIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARGTDPTAHSSVPSFEYFQNAGLLSQGSKAQRPRQELMGNHLVSLSGGS
TVVVVEGGSGGAVASEHSEQGYGVSLCHQAGVQWCDLGSLKSPPPGFKHFSCVSIPSSWD
YRCTPPRPASFLCVSPYGVLLCRPGWRGQGCTVCWPSVAQHNPSHTCQCSHEGALSSLCE
KTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEH
CERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHCRAGYTGLR
CEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKP
GFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFW
NLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRACD
CDSRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVVQDL
AAHTRRLEQRAQELQQTGVLGAFESSFWHMQEKLRIVQGIVGARNTSATSTAQLVEATEA
LRREIGEATEHLTQLEEELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHS
NFLGAYDSIRHSHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHM
ANQQALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGLSCNG
AAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAHQRAQAALDKANASRGQ
VEQANQELRELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQYLAGAIAERVR
SLADVDAILARTVGDVRRAEQLLQDARRARSRAEDEKQKAEIVQAALEEAQRAQGVAEGA
IRGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALRLKWAGNSLAASTA
EETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARDLLQA
AQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences ENSNLEP00000008291 ENSNLEP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]