SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008314 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008314
Domain Number 1 Region: 1203-1566
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.79e-124
Family Hect, E3 ligase catalytic domain 0.0000000091
Further Details:      
 
Domain Number 2 Region: 806-841
Classification Level Classification E-value
Superfamily WW domain 0.00000000000918
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 977-1019
Classification Level Classification E-value
Superfamily WW domain 0.0000000000325
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 191-292
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000156
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008314   Gene: ENSNLEG00000006821   Transcript: ENSNLET00000008706
Sequence length 1572
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:40180551:40432513:-1 gene:ENSNLEG00000006821 transcript:ENSNLET00000008706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSS
LTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQ
IVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLH
SRKLISFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFPTCAHHGQERRSTIISNTT
NPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAIGDQMLS
YNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGSPSDDEDMPGS
HHDSQVCSNGPVSEDSAADGTPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSLNDYL
DAIEHNGPSRPGTVTCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPS
SLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEGSTHEAASFEDKPENLPELAESS
LPAGPAPEEGEGGPESQPSADQGSAELCGSQEVDQPTSGADTGTSDASGGSRRAVSETES
LDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLECADSSCNESVTTQLSSVDTRC
SSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGP
GAESATVPDQEELGEVWQRRGSQEGAAAAAESPPQEEGCAGEAQGTCEGATAQEEGATGG
SQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTA
PPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRR
ENILPHSTSRSRLTLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRD
THHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPL
QSSRPTSALVHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDVVPVA
YNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRTEGTPGLVRLSSDADLVMLLS
LFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAKLRNF
YRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSG
PSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIH
QYLLDAFFTRPFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVF
GQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSV
FDARELELVIAGTAEIDLSDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFV
TGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLYEKLL
TAVEETSTFGLE
Download sequence
Identical sequences G1R542
ENSNLEP00000008314 ENSNLEP00000008314 XP_003253925.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]