SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008332 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008332
Domain Number 1 Region: 598-734
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-42
Family C-type lectin domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008332
Domain Number - Region: 220-426
Classification Level Classification E-value
Superfamily Tropomyosin 0.0017
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 77-266
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008332   Gene: ENSNLEG00000006846   Transcript: ENSNLET00000008725
Sequence length 742
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:16947619:17137546:-1 gene:ENSNLEG00000006846 transcript:ENSNLET00000008725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
TTVSQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGSQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPPGKEGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVG
RESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDVNNFICEKDRETVLSSAL
Download sequence
Identical sequences G1R560
ENSNLEP00000008332 XP_003262063.1.23891 ENSNLEP00000008332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]