SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008344 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008344
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.57e-59
Family Dystroglycan, domain 2 0.000000322
Further Details:      
 
Domain Number 2 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-18
Family Dystroglycan, N-terminal domain 0.00000273
Further Details:      
 
Domain Number 3 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008344   Gene: ENSNLEG00000006853   Transcript: ENSNLET00000008737
Sequence length 895
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:37716039:37779560:1 gene:ENSNLEG00000006853 transcript:ENSNLET00000008737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSLLHPLCGRTFLLLLSVAMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYISVSAARLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMAPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEASTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNSLEPDFKATSIAVMGSGSCRHLQFIP
VAPPRRVPSEVPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences G1R572
ENSNLEP00000008344 ENSNLEP00000023336 ENSNLEP00000008344 XP_003257112.1.23891 XP_003257113.1.23891 XP_003257114.1.23891 XP_003257115.1.23891 XP_003257116.1.23891 XP_003257117.1.23891 XP_003257118.1.23891 XP_003257119.1.23891 XP_003257120.1.23891 XP_004087943.1.23891 XP_012354454.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]