SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008410 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008410
Domain Number 1 Region: 433-557
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 2 Region: 236-328
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000985
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 335-436
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Cadherin 0.0085
Further Details:      
 
Domain Number 4 Region: 544-646
Classification Level Classification E-value
Superfamily Cadherin-like 0.000005
Family Cadherin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008410   Gene: ENSNLEG00000006902   Transcript: ENSNLET00000008805
Sequence length 785
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38015996:38025431:-1 gene:ENSNLEG00000006902 transcript:ENSNLET00000008805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLRLLMFLFAPVVSDLCSLPCFINVSESQGPGTILQFFSFNCSSYTPTPTLELLNVQP
PATFFNPPSLARWQGTYVGKLTLSSSARLDALIVNHYKLQLKFTCGNHVTEGSLSVDVQQ
DLSHIQCAGQFASPGRCLLGCWRVAAGLLMGVLRALGAESSLFCQMSIISAQDPPHFPGP
FSINEQGWLQAPSQGLLGQAQKVFQLQISVSFGQRQSCQGMVMVKVLPVPSSQVSFLEQA
QNITIPENLAPGSEVVQVRARGVDLRYEILSPVPSPHFSIGRADGVVRTTTPLELARTQG
TAVSRLQAKAFEQRQPWASAELNLTMNVQLVNLWPPRCLPALLVSQIPETAPVGTVLNTL
TCEDPDSVGTTLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGTCFQHAASILVLDG
GQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQEDAAPHTLLGSVVGTDMDYPHDNIEYY
TSGGPTNFAVDRLTGEVHLLGPLDYEQQRLYRLTVLLIDHGQDQNPNHHRSGSCTITIEV
EDVNDHAPWDPVHELAIYAPLGRSVEVTKVSCQIPQEPQRLYSYSIVGGNSQNQFILQGA
TLVHSDLVLGPFWPEQPRTYELLIRVADAGPSPTHLSTTATIIVHLVPRRASTVATSTHR
TTVPSTMTPMLITDTEAFWQPQPWFVVVLTATGALLLLALGWLLGRLLQGLAQLLQAPSK
PAQALLLNSIQGTEGSIEGFMEAPKMEMSQAPSTVMSLHFDGRAQDSRTGRDYLFNTHTG
ARRWL
Download sequence
Identical sequences ENSNLEP00000008410 ENSNLEP00000008410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]