SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008411 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008411
Domain Number 1 Region: 939-1144
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-39
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 2 Region: 643-833
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 512-612
Classification Level Classification E-value
Superfamily Fibronectin type III 6.56e-24
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 281-376
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 1585-1672
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 423-508
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000183
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 1362-1449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000159
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 1162-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000594
Family I set domains 0.039
Further Details:      
 
Domain Number 9 Region: 1492-1544
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000358
Family I set domains 0.033
Further Details:      
 
Domain Number 10 Region: 1258-1339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000037
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008411   Gene: ENSNLEG00000006889   Transcript: ENSNLET00000008806
Sequence length 1691
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:19871668:20032401:-1 gene:ENSNLEG00000006889 transcript:ENSNLET00000008806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPFYQRSHQHYDLSYRNKDLRTTVSHYQREKKRSAIYTQGSTAYSSRSSAAHRQESEA
FRQASASSFQQQASQYALSSEVSRKAASAYDYGSSYGLTDSSLLLDDYSSKLSPKPKRAK
HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
SKQSTASKQTTASKQSTASKQSMASKQSTASRQSTASKQSTASRQSVVSKQATSTLQQEE
TSEKKSRKVVIREKAEHLSLRKTLEETEAYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV
KLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINACDFEDTAQYRASA
MNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASKFEIHFDDKFDVS
FGREGETMSLGCRVVITPDIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNK
EDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA
VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKTGIGF
PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV
VLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLVEGKSYCFRVRC
SNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE
ASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAA
IGGGVSPDVCPTLSDEPGGLTTSRGHVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGHT
EVSKVSETVQEELTPPPQKAAPQGKSKSDPQKKKTDRAPPSPPCDITCLESFRDSMLLGW
KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMLYQFQVAAM
NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF
VDLKEAKAKEDQWRGLNEAAIKNIYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV
AETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK
MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEI
LEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEG
TYTFQLQDGKATNHSTVVLIGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNV
LLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDR
GKDKSRLKLVDEAFKELMTEVCKKIALSATDLKIQSTAEGIRLYSFVTYYVEDLKVNWSH
NGTAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEA
YAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA
SDDHCNLRFEAGKTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAA
LESLKGGKKAK
Download sequence
Identical sequences ENSNLEP00000008411 XP_003262073.1.23891 ENSNLEP00000008411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]