SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008456 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008456
Domain Number 1 Region: 873-1180
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000914
Further Details:      
 
Domain Number 2 Region: 1141-1439
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 
Domain Number 3 Region: 2-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-42
Family MAM domain 0.0000000226
Further Details:      
 
Domain Number 4 Region: 359-553
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-29
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 257-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000279
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 166-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000066
Family I set domains 0.0000147
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008456
Domain Number - Region: 572-609,662-710
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0338
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008456   Gene: ENSNLEG00000006934   Transcript: ENSNLET00000008856
Sequence length 1441
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:24792881:25423678:1 gene:ENSNLEG00000006934 transcript:ENSNLET00000008856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGCLFDEPYSTCGYSQSEDDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHL
LLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAE
LAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATF
QCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRT
EGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAREVEYCTAS
GSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPR
KLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQH
TITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLPGAVPTESIQGSTFEEKIFLQWR
EPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYSFTIR
ASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPVSVYQIV
VEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTY
NGYWNTPLLPYKSYRIYFQAASRANGETKIDCVRVATKGAATPKPVPEPEKQTDHTVKIA
GVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDE
AFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDPFVPTAILVLFLDETHTMASD
TSSLVQSHTYKKWEPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQ
SAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIAT
QGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETEL
LAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPL
VVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI
LEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLP
RNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDF
WRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIY
NAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLN
GGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNS
G
Download sequence
Identical sequences ENSNLEP00000008456 ENSNLEP00000008456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]