SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008460 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008460
Domain Number 1 Region: 131-256
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000196
Family Pentapeptide repeats 0.017
Further Details:      
 
Domain Number 2 Region: 406-530
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000892
Family Canonical RBD 0.0058
Further Details:      
 
Domain Number 3 Region: 644-743
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000059
Family Canonical RBD 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008460
Domain Number - Region: 533-566
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0458
Family Zn-finger domain of Sec23/24 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008460   Gene: ENSNLEG00000006932   Transcript: ENSNLET00000008860
Sequence length 1120
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38165330:38308974:1 gene:ENSNLEG00000006932 transcript:ENSNLET00000008860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGDSRPANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGH
SGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFSRDSSQLDFGRDIHS
GDFRDREGTMDYRGGDGTSMDYRGREAHHMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDL
DFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFREKDGTQVDFRGRGSGTT
DLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDR
EHSGMNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADFQNSQSP
VQDQDKSQLSGGEQQNSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFGYGQ
SKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPENATKEEILNAFRTPDGML
VKNLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIQDKEVTLEYVPSLDFWYCK
RCKASIGGHRSSCSFCKNPREVTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPE
PRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDREKESWSGETRQDGESKTIMLKRI
YRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLD
PPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQ
QSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSS
KKEMSKRDGKEKKDRGVTRFQENASEGKASAEDVFKKPLPPTVKKEESPPPPKVVNPLIG
LLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQ
FPNNEVLIKHQQLSDLHRQNLEIHRKIKQSEQELAYLERREREGKFKERGNDRREKLQSF
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEA
EGRMRGPSVGAPGRTSKRQSNETYRDAVRRVMFARYKELD
Download sequence
Identical sequences ENSNLEP00000008460 ENSNLEP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]