SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008472 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008472
Domain Number 1 Region: 275-514
Classification Level Classification E-value
Superfamily Caspase-like 5.68e-81
Family Caspase catalytic domain 0.000000514
Further Details:      
 
Domain Number 2 Region: 19-125
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-25
Family DEATH effector domain, DED 0.004
Further Details:      
 
Domain Number 3 Region: 112-189
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000129
Family DEATH effector domain, DED 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008472   Gene: ENSNLEG00000006951   Transcript: ENSNLET00000008873
Sequence length 522
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:45299929:45346072:1 gene:ENSNLEG00000006951 transcript:ENSNLET00000008873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQGQHWCSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLSCTKEEVERLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDDLTCLEDLCKTVVPK
LLRNIEKYKREKAAQIVTPPVDKEAESYQGEEELVSQTDFKTFLEALPEESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIINNHSFTSLKNR
QGTHKDAEILSHVFQWLGFTVRIHNDVTKGEMEKVLQEQKCNPAHADGDCFVFCILTHGK
FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRCEDILSIL
TAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLNALSL
Download sequence
Identical sequences ENSNLEP00000008472 ENSNLEP00000008472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]