SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008476 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008476
Domain Number 1 Region: 29-154,186-551
Classification Level Classification E-value
Superfamily Sema domain 1.19e-172
Family Sema domain 0.0000000000727
Further Details:      
 
Domain Number 2 Region: 613-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000192
Family I set domains 0.055
Further Details:      
 
Domain Number 3 Region: 547-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008476   Gene: ENSNLEG00000006953   Transcript: ENSNLET00000008877
Sequence length 785
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38388861:38423573:1 gene:ENSNLEG00000006953 transcript:ENSNLET00000008877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVASLLFWASLLTGAWPAFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDGNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPTPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNXXXXXXXXLIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQEMEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSVSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT
Download sequence
Identical sequences ENSNLEP00000008476 ENSNLEP00000008476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]