SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008501 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008501
Domain Number 1 Region: 29-517
Classification Level Classification E-value
Superfamily Sema domain 4.05e-183
Family Sema domain 0.0000000000108
Further Details:      
 
Domain Number 2 Region: 516-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000165
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 580-651
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000666
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008501   Gene: ENSNLEG00000006968   Transcript: ENSNLET00000008903
Sequence length 749
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38506036:38514786:1 gene:ENSNLEG00000006968 transcript:ENSNLET00000008903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAAVIPGLALLWAXXXXXXXXXPPRLRLSFQELQAWHGLQTFSLERTCCYEALLV
DEERGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNHTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEG
PTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPIGGRPL
FLQVGANYTFTQIAADRVAATDGHYDVLFIGTDAGTVLKVISVPKGSRPSAEGLLLEELH
VFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAATARVCTECCLARDPYCAWDGVA
CTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSNAFLECEPRSLQAR
VEWTFQRAEVTARTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEHGFTQPLRRLSL
HVLSATQAERLAQAEEAAPAAPRGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLP
LESRRKGRNRRTHAPEPRAERGPRSATHW
Download sequence
Identical sequences ENSNLEP00000008501 ENSNLEP00000008501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]