SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008515 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008515
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.53e-123
Family Bee venom hyaluronidase 0.0000151
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008515
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00255
Family EGF-type module 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008515   Gene: ENSNLEG00000006983   Transcript: ENSNLET00000008917
Sequence length 435
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38534918:38538817:-1 gene:ENSNLEG00000006983 transcript:ENSNLET00000008917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHLLPICALFLTLLDMAQGSRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
EFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVTAGDPNLPVLPYVQIFYDMTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRPSHPKALLLLNPASFSIQLTPGGGPLSLQGALSLEDQAQMAVEFKCRC
YPGWQGLWCEQKSMW
Download sequence
Identical sequences G1R5P3
ENSNLEP00000008515 XP_003257149.1.23891 ENSNLEP00000008515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]