SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008519 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008519
Domain Number 1 Region: 35-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.47e-123
Family Bee venom hyaluronidase 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008519
Domain Number - Region: 423-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00171
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008519   Gene: ENSNLEG00000006986   Transcript: ENSNLET00000008921
Sequence length 473
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38548135:38551703:-1 gene:ENSNLEG00000006986 transcript:ENSNLET00000008921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGPGPAVTLALVLAVAWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQEKDVYRRSSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSWAQCHGHGRCVRRNPSANTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADLDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAESHLTSLLVLAALAFTWAL
Download sequence
Identical sequences G1R5P7
ENSNLEP00000008519 XP_003257153.1.23891 XP_004087940.1.23891 ENSNLEP00000008519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]