SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008599 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008599
Domain Number 1 Region: 21-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000198
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008599   Gene: ENSNLEG00000007057   Transcript: ENSNLET00000009006
Sequence length 220
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:47942989:47975140:1 gene:ENSNLEG00000007057 transcript:ENSNLET00000009006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQHPQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACYSLLVTVAFSIFWMR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences G1R5X7
ENSNLEP00000008599 XP_003254017.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]