SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008603 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008603
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-17
Family V set domains (antibody variable domain-like) 0.000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008603   Gene: ENSNLEG00000007059   Transcript: ENSNLET00000009012
Sequence length 223
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:48105556:48110697:1 gene:ENSNLEG00000007059 transcript:ENSNLET00000009012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLGFQRHTAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQETEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Download sequence
Identical sequences G1R5Y1
ENSNLEP00000008603 XP_003254019.1.23891 ENSNLEP00000008603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]