SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008616 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008616
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000823
Family HEAT repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008616   Gene: ENSNLEG00000007076   Transcript: ENSNLET00000009026
Sequence length 269
Comment pep:novel supercontig:Nleu1.0:GL397262.1:22394192:22400330:-1 gene:ENSNLEG00000007076 transcript:ENSNLET00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IICKMASMLSESTFERLPLPRFCELCGDGKLFQVREVCAANFGDICHAVGQEATEKFLIP
KFFELCSDAVWGMRKACAECFTAVSHSSSPGVRRTQLSPLFIRLVSDPCWVHQAAFQSLS
PFISTFANPSRAGLYLREDGVLSIWPLTQDLDSGFASGSPAPSSGGNTSPASLTSSAKPV
QREPELPVEGTSAKTGNFPHISSSSDGPTENSVESSVSAGAELTRLSPETSAFSKLSDIN
DLPISSYPGSDSWACPGNTEDVFNHFLYW
Download sequence
Identical sequences ENSNLEP00000008616 ENSNLEP00000008616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]