SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008629 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008629
Domain Number 1 Region: 3822-4002
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-35
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 3229-3334
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-30
Family Cadherin 0.00087
Further Details:      
 
Domain Number 3 Region: 3125-3236
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 1554-1690
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 3335-3446
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-28
Family Cadherin 0.00055
Further Details:      
 
Domain Number 6 Region: 1136-1264
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-28
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 460-579
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 2808-2916
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 1029-1147
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 930-1033
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 2280-2386
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.00055
Further Details:      
 
Domain Number 12 Region: 146-268
Classification Level Classification E-value
Superfamily Cadherin-like 4e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 3023-3131
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 819-925
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 15 Region: 2588-2725
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-24
Family Cadherin 0.0034
Further Details:      
 
Domain Number 16 Region: 1763-1883
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 17 Region: 1454-1558
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-23
Family Cadherin 0.00081
Further Details:      
 
Domain Number 18 Region: 2072-2179
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 1666-1769
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 719-831
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 2917-3021
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 22 Region: 2490-2600
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-21
Family Cadherin 0.0035
Further Details:      
 
Domain Number 23 Region: 3434-3553
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 24 Region: 2180-2287
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 25 Region: 1242-1356
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 2387-2487
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 27 Region: 1871-1994
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 28 Region: 1980-2084
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 571-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000214
Family Cadherin 0.0021
Further Details:      
 
Domain Number 30 Region: 1361-1458
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000127
Family Cadherin 0.0072
Further Details:      
 
Domain Number 31 Region: 2705-2814
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000214
Family Cadherin 0.0044
Further Details:      
 
Domain Number 32 Region: 375-472
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000814
Family Cadherin 0.0065
Further Details:      
 
Domain Number 33 Region: 3547-3637
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 4094-4135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000667
Family EGF-type module 0.01
Further Details:      
 
Domain Number 35 Region: 4023-4061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000071
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 36 Region: 4060-4102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.02
Further Details:      
 
Domain Number 37 Region: 42-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000414
Family Cadherin 0.0059
Further Details:      
 
Domain Number 38 Region: 259-357
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008629   Gene: ENSNLEG00000007081   Transcript: ENSNLET00000009039
Sequence length 4589
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:25202035:25757590:1 gene:ENSNLEG00000007081 transcript:ENSNLET00000009039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIIMGHCVGTRPPPCCLILLLFKLLATVSQGLPGTGPLGFHFTHSIYNATVYENSAART
YVNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNRE
IQDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQV
TATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKL
YGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIES
VSIVSGDPLDQFFLAKDGKWLNEYKIKERKQIDWERFPYGYNLTLQAKDKGSPQKFSALK
AVYIGNPTRDTVPVRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVEYKLSPGEDAVYF
KINPRSGLIVTAQPLNTIKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAY
VNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSP
EIYRFVVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAV
SAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGEN
LADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINR
QGPYFDKSFPSDVAVKEDLPVDANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMET
GQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNI
LESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANY
SLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLET
HDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVS
LSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQY
SIRDGSGLGRFSIDDESGVITAADILDRETTGSYWLTVYATDRGVVPLYSTIEVYVEVED
VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINI
KTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVHVLDENDNKPQFPEKVYQ
IKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFT
AGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEI
VGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTN
VAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSS
IDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDAN
DHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNTFKIEPVL
GIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEV
NENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTRKALDYERTSSYQLI
IQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPVNSIVRSLDNSPLVIRA
TDADSNRNALLVYQIVELTAKKFFTVDSGTGAIRTIANLDHETIAHFHFHVHVRDSGSPQ
LTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTY
SLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYMLIVKVSDGKFYSTSMVTIMVKEAMDSGL
HFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGV
PFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYATVQVDAEPG
TLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILA
KDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIY
IIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDV
NDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHID
SSSGLILTARMLDHELVQHCTLKVRSTDSGFPSLSSEVLVHIYISDVNDNSPVFNQLIYE
SYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQR
MEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRA
TDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRALDGGGR
TTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLY
SEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLP
PETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVRFSTVNGERPENNKGGVFVIEQ
ETGTIKLDKRLDHETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYD
TIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKD
LDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEAYRGNVKESDPPG
EVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFL
NITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNEIILKVSAKDADIGS
NGDIRYSLYGSGNSEFFLDSESGELKTLALLDRERIPMYSLMAKATDGGGRFCQSNIHLI
LEDVNDNPPVFSSDHYNACVHENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSI
DSSSGIIILEQPLDREQQSSYNISVWATDQSPGQSLSSLTTVTITVLDINDNPPVFERRD
YLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGDISVSEVLD
YELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSV
ILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVD
SGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGP
PFSFSILSGNEEEEFVLDPHGILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVR
VIEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNS
HDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPED
FVGLHMHGFRRTLRNVVLTQKQDSLRIISIQPVAGTNQLDMLFAVEMHSSEFYKPAYLIQ
KLSNARRHLENIMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFY
RNVRCTCNGGLCPGSSDPCMEKPCPADMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSF
AGNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGS
GPGILGISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGA
LVQADNIRSLTDTRVTQVLSGFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVL
YPDACERSPCQHGGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGN
AFICNCKAGLTGVMCEEDINECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVV
PNIQAGHSYVGKEELIGIAVVLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAAL
LNKSNGIPFRNLRGSGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEH
QEMTTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKGVDDPG
EVTCFAGSNKGSNSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNY
NRAYHWDTSDWMPGARLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPP
HEEEFLSQDQLPPPLPEDFPDQYEALPPSQSVSLASTLSPDCRRRPQFHPSQYLPPHPFP
NETDLVGPPASCEFSTFAVSMNQGTEPTGPADSVSLSLHNSRGTSSSDVSANCGFDDSEV
AMSDYESVGELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences ENSNLEP00000008629 ENSNLEP00000008629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]