SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008653 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008653
Domain Number 1 Region: 37-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000234
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008653   Gene: ENSNLEG00000007101   Transcript: ENSNLET00000009064
Sequence length 200
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:26794553:26826363:-1 gene:ENSNLEG00000007101 transcript:ENSNLET00000009064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLPSGRRKTRGISLGLFALCLAAARCLQSQGVSLYIPQATINATVKEDILLSVEYSCH
GVPTIEWTYSSNWGTQKIVEWKPGTQANISQSHKDRVCTFDNGSLQLFSVGVRDSGYYVI
TVTERLGSSQFGTIVLHVSEILYEDLHFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRK
RGHKLKESTTEEIELEDVEC
Download sequence
Identical sequences G1R631
ENSNLEP00000008653 ENSNLEP00000008653 XP_003253049.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]