SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008702 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008702
Domain Number 1 Region: 30-525
Classification Level Classification E-value
Superfamily Sema domain 4.32e-159
Family Sema domain 0.000000000184
Further Details:      
 
Domain Number 2 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000241
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 588-673
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000126
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008702   Gene: ENSNLEG00000007140   Transcript: ENSNLET00000009118
Sequence length 782
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:40508515:40520979:-1 gene:ENSNLEG00000007140 transcript:ENSNLET00000009118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQA
MYLDEYRDRLFLGGLDALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFV
RVLQPHNRTHLLACGTGAFQPTCALITVGHRGEHVLHLEPGSVESGRGRCPHEPSRPFAS
TFIGGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHDPRFVMAARIPENSDQDN
DKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIWEVFNGPFAHR
DGPQHQWGPYGGKVPFPRPGVCPSKMTAQPGRPFDSTKDYPDEVLQFARAHPVMFWPVRP
RHGRPVLVKTHLAQQLHQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEV
VLEELQVFKVPTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYC
AWDGASCTHYRPSLGKRRFRRQDIRHGNPALQCLGQSQEEEAVGLVAATTVYGTEHNSTF
LECLPKSPQAAVHWLLQRPGDEGPDQVKTDERVLHTDRGLLFRRLSRFDAGTYTCTTLEH
GFSQTVVRLALVVIVASQLDNLFPLEPKPEEPPARGGLASTPPKAWYKDILQLIGFANLP
RVDEYCERVWCRGTMECSGSFRSRSRGKQTKGKSWAGLELGKRMKSRVHAEHNRTPREVE
AT
Download sequence
Identical sequences G1R680
ENSNLEP00000008702 ENSNLEP00000008702 XP_003257212.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]