SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008708 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008708
Domain Number 1 Region: 653-859
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-33
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 2 Region: 861-1045
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-29
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 3 Region: 367-460
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.00039
Further Details:      
 
Domain Number 4 Region: 463-558
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 282-377
Classification Level Classification E-value
Superfamily Immunoglobulin 8.87e-20
Family I set domains 0.0021
Further Details:      
 
Domain Number 6 Region: 82-177
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-16
Family I set domains 0.00078
Further Details:      
 
Domain Number 7 Region: 186-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000412
Family I set domains 0.00046
Further Details:      
 
Domain Number 8 Region: 555-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000467
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008708   Gene: ENSNLEG00000007147   Transcript: ENSNLET00000009124
Sequence length 1084
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:32885332:33436741:1 gene:ENSNLEG00000007147 transcript:ENSNLET00000009124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEYSKALPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWRGAAQNY
YSPINLYHSSDAFKQDESVDYGPVFVQEPDDIIFPTDSDEKKVALNCEVRGNPIPSYRWL
RNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATNTLGSILSREATLQFAYLGN
FSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYI
SKVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGT
TVKVECFALGNPVPTITWMKVNGYIPSKARLRKSQAVLEIPNVQLDDAGIYECRAENSRG
KNSFRGQLQVYTYPHWVEKLNDTQLDSGSPLRWECKATGKPRPTYRWLKNGVPLSPQSRV
EMVNGVLMIHNVNQSDAGMYQCLAENKYGAIYASAELKILASAPTFALNQLKKTIIVTKD
REVVIECKPQGSPKPTISWKKGDRAVRENKRIAILPDGSLRILNASKSDEGKYVCRGENV
FGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDASLDVTFYWTLKGQPIDF
EEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVRGPPGPPGI
VIVEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVKTVPEIITGDMESAMAV
DLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTNVSGRSGRRHELVIAWEP
VSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPLTPFEVKVGVYNN
KGDGPFSQIVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKD
MEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKKSPPSQ
APGNLRWEQQGSQVSLSWEPVIPLANESEVVGYKVFYRQEGHSNSQVIETQKLQAVVPLP
DAGVYIIEVRAYSEGGDGTASSQIRVPSYSGGKITSAQSTLHTLSTSSSSVTLLLALMIP
STSW
Download sequence
Identical sequences ENSNLEP00000008708 ENSNLEP00000008708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]