SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008717 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008717
Domain Number 1 Region: 2169-2262
Classification Level Classification E-value
Superfamily C-type lectin-like 3.3e-32
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1433-1481,1562-1673
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1675-1828
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-26
Family FAS1 domain 0.0042
Further Details:      
 
Domain Number 5 Region: 385-498
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 6 Region: 964-1117
Classification Level Classification E-value
Superfamily FAS1 domain 1.01e-19
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 7 Region: 2260-2423
Classification Level Classification E-value
Superfamily FAS1 domain 5.76e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1505-1542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008717
Domain Number - Region: 1331-1458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000953
Family Merozoite surface protein 1 (MSP-1) 0.028
Further Details:      
 
Domain Number - Region: 1970-2097
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00102
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 829-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family EGF-like domain of nidogen-1 0.069
Further Details:      
 
Domain Number - Region: 905-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 1937-1970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2101-2137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-like domain of nidogen-1 0.06
Further Details:      
 
Domain Number - Region: 863-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-like domain of nidogen-1 0.078
Further Details:      
 
Domain Number - Region: 230-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008717   Gene: ENSNLEG00000007151   Transcript: ENSNLET00000009134
Sequence length 2531
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:40572366:40601747:1 gene:ENSNLEG00000007151 transcript:ENSNLET00000009134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQKLRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINGNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQVPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGSCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFSDYKGIACHICSNPNKHGDQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGQFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVVRCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDVRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWFKSAGVTLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRMLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVRVQNASVDVADLLATNGVLHILSQVQQEEGVCRETCKQLSCSPLGSLF
LCQDADTVRHHVVLGEALSMETLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPML
EAPGRSLIGLSGVLTVGSSRCLHSHAEALREKCVNCTRKFRCTQGFQLQDTPKKSCVYRS
GFSFSRGCSYTCAKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCH
EGFHGTACEMCELGRYGPNCSGVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQ
CPRKCDPNANCVQDSAGASTCACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQ
RTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCE
LLDPCSKNNGGCSPYATCKSTGDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFS
LRLLEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLL
EQGYATALSGHPLRFSEREGSIYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPD
DAPIPRRNVTAAAKGFGYKIFSGLLKVAGLLPLLREASHRPFTMLWPTDAAFRALPPDRQ
AWLYHEDHRDKLAAVLRGHMIRNVEALASDLPNLGPLRTMHGTPISFSCSRARPGELMVG
EDEARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGS
QEQGSPEACWRFYPKFWTSPPLRSLGLRSVWVQPSLWGRPQGLGRGCHRNCVTTTWKPSC
CPGHYGSECQACPGGPSSPCSDRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQ
ACRCTVHGRCDEGLGGSGSCFCDEGWNGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECS
LGYEGDGRVCTVADLCQDGHGGCSEHANCSQVGTVVTCTCLPDYEGDGWSCRARNPCTDG
HRGGCSEHADCLSTGLNTRRCECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAVCTD
LHFQEKRAGVFHLQATSGPYGLNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWL
ANGSTAHPVVFPAADCGNGRVGIVSLGARKNLSEHWDAYCFRVQDVACRCRDGFVGDGIS
TCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDN
MTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSH
IIVWDIMAFNGIIHALASPLLAPPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYL
RARGKPTGFGFSAFQAEDDADNDFSPWQEGTNPTLVSVPNPVFGSDAFCEPFDDSLLEED
FPDTQRILTVK
Download sequence
Identical sequences ENSNLEP00000008717 ENSNLEP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]