SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008780 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008780
Domain Number 1 Region: 689-981
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-80
Family Protein kinases, catalytic subunit 0.000000000484
Further Details:      
 
Domain Number 2 Region: 21-181
Classification Level Classification E-value
Superfamily L domain-like 2.13e-46
Family L domain 0.0000143
Further Details:      
 
Domain Number 3 Region: 299-491
Classification Level Classification E-value
Superfamily L domain-like 7.66e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 4 Region: 476-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.05e-22
Family Growth factor receptor domain 0.0000026
Further Details:      
 
Domain Number 5 Region: 160-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-18
Family Growth factor receptor domain 0.000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008780   Gene: ENSNLEG00000007195   Transcript: ENSNLET00000009198
Sequence length 1282
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:55824468:56594284:-1 gene:ENSNLEG00000007195 transcript:ENSNLET00000009198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGY
VLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGG
VYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQ
TLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTF
VYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPC
TDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDP
EKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQ
FQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHL
CSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGL
LTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCN
GPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRAL
RRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKI
PVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLE
YVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLAR
LLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPT
REIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLV
IQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRS
EIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSC
CNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPV
EENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANALGKAEYLKNNV
LSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLS
EFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences ENSNLEP00000008780 ENSNLEP00000008780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]