SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008783 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008783
Domain Number 1 Region: 198-461
Classification Level Classification E-value
Superfamily Caspase-like 4.04e-83
Family Caspase catalytic domain 0.000000000756
Further Details:      
 
Domain Number 2 Region: 61-147
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-24
Family Caspase recruitment domain, CARD 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008783   Gene: ENSNLEG00000007200   Transcript: ENSNLET00000009201
Sequence length 462
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:38112293:38123362:-1 gene:ENSNLEG00000007200 transcript:ENSNLET00000009201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLPDAGYSSDSLMGRKIKICIYMHSEYFPIRVQALPKRKAKHTFSFSHTRREERKAMA
DKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVT
PKGAQACQICITYICEEDKYLAQTLGLSADQTSGNSLNMQDSQGVLSSFPALQAVQDNPT
MPTSSGSEGNVKLCSLEEAQRIWKEKPVEIYPIMDKSSRTRLALIICNEEFDTLPRRTGA
EVDIAGMTMLLQNLGYSVDVKKNLAASDMTTELQAFAHRPEHKTSDSTFLVFMSHGILEG
ICGKKHSEQVPDVLQLNAIFKMLNTKNCPSLKDKPKVIIIQACRGDGYGVVWLKDSAGVS
RNVSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTKGSVFIMRLIEHLQEYAC
SCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Download sequence
Identical sequences XP_012351229.1.23891 ENSNLEP00000008783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]