SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008819 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008819
Domain Number 1 Region: 39-326,511-574
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-89
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.69e-56
Family GMC oxidoreductases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008819   Gene: ENSNLEG00000007229   Transcript: ENSNLET00000009238
Sequence length 594
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:41984131:42008137:-1 gene:ENSNLEG00000007229 transcript:ENSNLET00000009238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLLRGLGRPGTLARGALGQQQPLGTRALASAGSESRDEYSYVVVGAGSAGCVLAGRLT
EDPTERVLLLEAGPKDVRAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVL
YWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASLY
RGADGPLRVSRGKTNHPLHRAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSA
ACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAIN
SPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLR
KVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAP
FRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENL
RVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGRPALWDKDVPVYKPRTLATQR
Download sequence
Identical sequences G1R6J7
ENSNLEP00000008819 XP_012354418.1.23891 ENSNLEP00000008819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]