SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008836 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000008836
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0162
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008836   Gene: ENSNLEG00000007246   Transcript: ENSNLET00000009256
Sequence length 884
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:43364631:43405532:1 gene:ENSNLEG00000007246 transcript:ENSNLET00000009256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYFPANEYGVLCIQEYRKNSKVESSTRNSFMGLKDHLGHDLSHLYVESTDPQLSPAVP
WSTVEKPSMDTVNAGKDEKEVSEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQ
LCRSPCLEPHILKRNEILQDFKPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQV
QLVLNKLGTDALINDILGELVKLGNKSEADQTVSTINTITREASSLESQRSESPMQEIVT
DDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLERGHKDITVFVPAWRKEQSRP
DALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGIIVSNDNYRDL
ANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYG
KKCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADST
SDVKRGAPKRQSDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKAQSTTSLS
NGLPSGVHFPPQDQRPQGQYPSMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNL
SLSGPRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEEN
LKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKPPLPHLALHLQHSAVGARS
SCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWER
PGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNRE
KIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY
Download sequence
Identical sequences A0A2I3GRN3
ENSNLEP00000008836 ENSNLEP00000008836 XP_003253154.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]