SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008852 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008852
Domain Number 1 Region: 33-178
Classification Level Classification E-value
Superfamily C-type lectin-like 1.13e-30
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008852   Gene: ENSNLEG00000007260   Transcript: ENSNLET00000009272
Sequence length 374
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:44815294:44839430:1 gene:ENSNLEG00000007260 transcript:ENSNLET00000009272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRTALQAVVLAVLLVGLRAATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAK
EACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWT
DGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSD
EKPAVPSREAEGEETEPTTPVLPEETQEEDAKKTFKESREAALNLAYILIPGIPLLLLLV
VTTVVCWVWICRRRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRP
DLKNISFRVCSGEATPDDMSRDYDNMAVNPSENGFVTLVSVESGFVTNDIYEFSPDQMGR
SKESGWVENEIYGY
Download sequence
Identical sequences A0A2I3H5U4
ENSNLEP00000008852 XP_003253165.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]