SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008875 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008875
Domain Number 1 Region: 225-315
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-23
Family Thyroglobulin type-1 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 44-141
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.85e-18
Family Growth factor receptor domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008875   Gene: ENSNLEG00000007277   Transcript: ENSNLET00000009295
Sequence length 330
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:61318124:61361164:1 gene:ENSNLEG00000007277 transcript:ENSNLET00000009295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTASMLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGP
PPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHP
GSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGS
AGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVL
ERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQ
GAPTIRGDPECHLFYNEQQEARGVHTQRMQ
Download sequence
Identical sequences ENSNLEP00000008875 XP_003254105.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]