SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008878 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008878
Domain Number 1 Region: 185-266
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.94e-26
Family Thyroglobulin type-1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-24
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008878   Gene: ENSNLEG00000007279   Transcript: ENSNLET00000009298
Sequence length 272
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:61383607:61403634:-1 gene:ENSNLEG00000007279 transcript:ENSNLET00000009298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Download sequence
Identical sequences G1R6Q6
XP_003254106.1.23891 ENSNLEP00000008878 ENSNLEP00000008878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]