SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008960 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008960
Domain Number 1 Region: 718-921
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-38
Family Fibronectin type III 0.00000335
Further Details:      
 
Domain Number 2 Region: 1214-1393
Classification Level Classification E-value
Superfamily Fibronectin type III 8.12e-31
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 919-1119
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-26
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 4 Region: 57-145
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 514-617
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 424-524
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 239-339
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-19
Family I set domains 0.009
Further Details:      
 
Domain Number 8 Region: 1120-1219
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 140-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000293
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 340-430
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000434
Family I set domains 0.052
Further Details:      
 
Domain Number 11 Region: 619-722
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000252
Family I set domains 0.043
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008960
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0333
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008960   Gene: ENSNLEG00000007345   Transcript: ENSNLET00000009382
Sequence length 1884
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:50976287:51080929:-1 gene:ENSNLEG00000007345 transcript:ENSNLET00000009382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PENRFFITYHGGLYISDVQKEDALSTYRCITKHKYSGETRQSNGARLSVTDPAESIPTIL
DGFHSQEVWAGHTVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTEDS
GTYICEVTNTFGLAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWY
RNTELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPR
IVSSFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISH
MNVTGPQIRDGGVYRCTARNSVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVI
GYPYYSIKWYKDALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSV
HVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKE
FMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVL
NCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQA
SNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVI
DPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPD
PPELEIREVKARSMNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANI
VDLHPASVYSIRMYSFNKIGRSEPSKELTVSTEEAAPDRRRWILAISPVTSQSIQVTWKA
PKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAF
NRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVI
FWSLYVDGEWGEMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKED
GDPTPGGRVRAVSDSAGSAVALWLPRTAPGLVKSFSVWNSSNGAAEPAPSEYETSPEQLF
YRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRL
PCNSVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTG
GFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEEWK
DVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFT
HINSTHARLNLQGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWYEL
RMRACNSAGCGNETAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALL
FIVRKKRKEKRLKRLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDK
EGIKQLGDDKATIPVTDAEFSQAVNPQSFCTGVSLHHPALIQSTGPLIDMSDIRPGTNPV
SRKNVKSAHSTRNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQ
DTDKGRNSMVSTESASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTN
ENADSMTSMSTPSEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEA
FFRKADGREPCPVVPPREASIRNLARTYHTQARHLTLDPASKPLGLPHPGAPAATSTATL
PQRTLAMPAPPAGTAPPAPGPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLE
MSTSGVGRSQKQGAGAYSKSYTLV
Download sequence
Identical sequences ENSNLEP00000008960 ENSNLEP00000008960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]