SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008965 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008965
Domain Number 1 Region: 277-521
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-87
Family Eukaryotic proteases 0.0000552
Further Details:      
 
Domain Number 2 Region: 187-283
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-18
Family Hepsin, N-terminal domain 0.022
Further Details:      
 
Domain Number 3 Region: 166-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000995
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008965   Gene: ENSNLEG00000007349   Transcript: ENSNLET00000009388
Sequence length 529
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51470756:51487865:-1 gene:ENSNLEG00000007349 transcript:ENSNLET00000009388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASPARTPSAEASPAQASPAGTPPGRASPAQASPTQASPAGTPPGRASPARASPGLASPS
RSSSSRSSSARSASVTTSPTRVYLVRATPVGAVPVRSSPARSAPAARATRESTGTSLPKF
TWREGQKRLPLIGCVLLLIALVVSLIILFWFWRGHTGIRYKEQRESCPKHAVRCDGVVDC
KLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAYRTTEV
AHRDFANSFSILRYNSTIQESLHRSECPSQRYISLQCSHCGLRAVTGRIVGGALASDSKW
PWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASI
AEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHLACLPMHQTFSLNETCWITGFGKTRE
TDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCE
QNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMESEVRFRKS
Download sequence
Identical sequences ENSNLEP00000008965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]