SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008968 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008968
Domain Number 1 Region: 122-227
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-46
Family Fibronectin type III 0.0000014
Further Details:      
 
Domain Number 2 Region: 25-115
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-16
Family Fibronectin type III 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008968   Gene: ENSNLEG00000007350   Transcript: ENSNLET00000009391
Sequence length 576
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51557974:51572942:1 gene:ENSNLEG00000007350 transcript:ENSNLET00000009391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIEPWNSISNCSQALSYDLTAVTLDLYRSNGYRARVRAVDGSRHSNWTIANTRFSV
DEVTLTVGSVKLETHNGFILGKIQPPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRTNKGVWSKEECVSLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQCPSPETQDTIHPLDEEA
FLKVSPELRNSDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPRADRTLGNGEPPVLGDSC
NSGSSNSTDSVICLQSPLSPSPGPAWEQQVGSNSSCQDDSGIGLQNSEGRAGDTQGGSAL
GHHSPPEREVPGEEDPAAVAFRGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLD
DEAGLHLPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGTSDWSFA
HDLGPLGCVAAPGSLLGSFNSDLVTLPLISSLQSSE
Download sequence
Identical sequences ENSNLEP00000008968 ENSNLEP00000008968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]