SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008971 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008971
Domain Number 1 Region: 39-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000851
Family V set domains (antibody variable domain-like) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008971   Gene: ENSNLEG00000007352   Transcript: ENSNLET00000009394
Sequence length 228
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51712287:51731870:-1 gene:ENSNLEG00000007352 transcript:ENSNLET00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATNIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRIALVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
Download sequence
Identical sequences G1R6Z9
ENSNLEP00000008971 XP_003253265.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]