SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008974 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008974
Domain Number 1 Region: 26-125
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-17
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 
Domain Number 2 Region: 138-240
Classification Level Classification E-value
Superfamily Immunoglobulin 5.03e-16
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008974   Gene: ENSNLEG00000007354   Transcript: ENSNLET00000009397
Sequence length 394
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51774877:51808514:-1 gene:ENSNLEG00000007354 transcript:ENSNLET00000009397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCPLKLVLLPVLLDYSLGLNDLNVSPAELTVHVGDSALMGCVFQSTEDKCIFKIDWILS
PGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMRDVLCNDGSLLLQDVQEADQGTYTCEIRH
KGESQVFKKAVVLRVLPEEPKELMVRVGELIQMGCVFQSTEVKHVTKVEWIFSGRRAKEE
IVFRYYHKLRMSAEYSQSWGHFQNRVNLVGDIFRNDGSITLQGVRESDGGNYTCSIHLGN
LVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLMLIVKRTC
GNKSSVNSTVLVKNTKKTNPGIKEEPWHFERYEGEKHIYSPIIVREVIEEEEPSEKSEAT
YMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF
Download sequence
Identical sequences G1R702
ENSNLEP00000008974 ENSNLEP00000008974 XP_003253267.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]