SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008977 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008977
Domain Number 1 Region: 37-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000149
Family I set domains 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008977   Gene: ENSNLEG00000007357   Transcript: ENSNLET00000009400
Sequence length 198
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51884107:51894630:1 gene:ENSNLEG00000007357 transcript:ENSNLET00000009400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGTCWRVLGLCLLSVGVWGQDGNEEMGKRISTPYKVSISGTTVIVTCPQYSGSEIVWQ
HNDKIIKNYDDHLSLKEFSEMEQSGYYVCYPRGSKPEDASFYLYLRARVCENCMEMDVMA
VATIVIVDIGITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYE
PIRKGQRDLYSGLNQRRI
Download sequence
Identical sequences ENSNLEP00000008977 ENSNLEP00000008977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]