SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008986 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008986
Domain Number 1 Region: 172-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000158
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008986
Domain Number - Region: 281-354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00433
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008986   Gene: ENSNLEG00000007367   Transcript: ENSNLET00000009410
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:52107247:52112137:1 gene:ENSNLEG00000007367 transcript:ENSNLET00000009410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGERRSLWERGAWRPSMSVCECACVQGVVARMLAASAYLQACACLFCSLESVLGSAPA
GCPGVCWVGLCFWALPFVSVPSPLGARLHLRFRTWLFLFLESKFLEQLLGLPAVTWLTGR
PAPFSRQPRAQARATMALPQSPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALREN
ERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHEL
NCSLQDPSSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTW
IDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPG
LLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRRPSLISSDSNNLK
LNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFI
RLPMLGYIYRVSSVSSDEIWL
Download sequence
Identical sequences XP_012351326.1.23891 ENSNLEP00000008986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]