SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009018 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009018
Domain Number 1 Region: 249-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000377
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 137-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000954
Family I set domains 0.05
Further Details:      
 
Domain Number 3 Region: 346-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000997
Family I set domains 0.045
Further Details:      
 
Domain Number 4 Region: 33-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000961
Family V set domains (antibody variable domain-like) 0.028
Further Details:      
 
Domain Number 5 Region: 429-513
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000458
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009018   Gene: ENSNLEG00000007393   Transcript: ENSNLET00000009442
Sequence length 645
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:52870570:52878685:-1 gene:ENSNLEG00000007393 transcript:ENSNLET00000009442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRLVCAFLLAACCCCPLVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLGHV
DWFTVHKEKRILIFRVRQGQGQSEPGEYQQRLSLQDRGATLALTQVTPHDERIFLCQGKR
PRSQEYRIQLRVYKAPEEPNIQVNAQGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRP
LKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESRE
VTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN
DNGVLVLEPARKEHSGLYECQGLDLDTMISLPSEPQELLVNYVSDVRVSPAAPEKQEGSS
LTLTCEAESSQDLEFQWLREETGQVLARGPVLQLHHLKREAGGGYCCVASVPSIPGLNRT
QRVSVAIFGPPWMAFKERKVWVENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVL
XXXXXXVTPELLETGVECTASNDLGKNTSVLFLELVNLTTLTPDSNTTTGLSTSTASPHT
RANSTSTERKLPEPESQGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCGRSGKQEITLP
PSRKSEFVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Download sequence
Identical sequences ENSNLEP00000009018 ENSNLEP00000009018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]