SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009019 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009019
Domain Number 1 Region: 300-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-36
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 144-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 3 Region: 464-576
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.84e-28
Family Frizzled cysteine-rich domain 0.00029
Further Details:      
 
Domain Number 4 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 419-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009019   Gene: ENSNLEG00000007395   Transcript: ENSNLET00000009444
Sequence length 579
Comment pep:novel supercontig:Nleu1.0:GL397262.1:52899585:52907855:-1 gene:ENSNLEG00000007395 transcript:ENSNLET00000009444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVILCVEATELSKTEFCNPAFEPESGPPCLPPVFPEDASYSVPAPWHGRRPRGLR
PDCRFSWLCVLLLSSLLLLLLGLLVAIILAQLQAAPPSGASHSPLPAGGLTTTTTTPTIT
TSQAAGTPKGQQESSVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNAHCVWHIQVATDH
AIQLKIEALSIESVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASHLLVVFISDSS
VEGFGFHAWYQAVAPGHGSCAHDEFRCDQLICLLPDSVCDGFANCADGSDETNCSAKFSG
CGGNLTGLQGTFSTPNYLQQYPHQQLCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVE
VYEASSSGAFSLLGRFCGAEPPPNLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENP
CGPSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSGPLFPPPELACEPVQVEMCLGLSYN
TTAFPNIWVGMTTQEEVVEVLSGYKSLTSLPCYQNFRRLLCGLLVPHCTPLGSVLPPCRS
VCQEAEHQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences G1R747
ENSNLEP00000009019 XP_003253322.1.23891 ENSNLEP00000009019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]