SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009022 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009022
Domain Number 1 Region: 29-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000341
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009022   Gene: ENSNLEG00000007398   Transcript: ENSNLET00000009448
Sequence length 161
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:52977636:52985053:-1 gene:ENSNLEG00000007398 transcript:ENSNLET00000009448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTTSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Download sequence
Identical sequences A0A0D9S3W8 A0A2K5IHC4 A0A2K5LRF7 A0A2K5R9E8 A0A2K5ZXH3 A0A2K6B1T6 A0A2K6K5Q9 A0A2K6PXS3 F7EW76 G7PPB4
ENSNLEP00000009022 ENSMMUP00000011701 9544.ENSMMUP00000011701 NP_001036103.2.72884 XP_003253323.1.23891 XP_003253324.1.23891 XP_003253325.1.23891 XP_005579976.1.63531 XP_008019391.1.81039 XP_008019392.1.81039 XP_010355283.1.97406 XP_010355284.1.97406 XP_011730516.1.29376 XP_011782342.1.43180 XP_011782343.1.43180 XP_011782344.1.43180 XP_011782345.1.43180 XP_011820339.1.47321 XP_011820340.1.47321 XP_011820342.1.47321 XP_011820343.1.47321 XP_011908502.1.92194 XP_012351369.1.23891 XP_017379035.1.71028 XP_017725975.1.44346 XP_017725976.1.44346 ENSPANP00000008630 ENSNLEP00000009022 ENSMMUP00000011701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]