SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009023 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009023
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 243-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000692
Family I set domains 0.0097
Further Details:      
 
Domain Number 3 Region: 170-247
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000431
Family C1 set domains (antibody constant domain-like) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009023   Gene: ENSNLEG00000007399   Transcript: ENSNLET00000009449
Sequence length 515
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:53238339:53303110:-1 gene:ENSNLEG00000007399 transcript:ENSNLET00000009449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMGLAGAAGRWWGFALGLTAFFLPGAHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLQAKKGQDDKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLT
LNVQYEPEVTIEGFDGWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLF
FKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTAIIGGVA
GSVLLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPDD
SDDEKKAGPLGGSSYEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYG
DRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
Download sequence
Identical sequences G1R751
ENSNLEP00000009023 ENSNLEP00000009023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]