SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009031 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009031
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 1.13e-23
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 913-971
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000245
Family BSTI 0.045
Further Details:      
 
Domain Number 3 Region: 1298-1357
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000818
Family BSTI 0.055
Further Details:      
 
Domain Number 4 Region: 1687-1746
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000085
Family ATI-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009031
Domain Number - Region: 2404-2445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00331
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009031   Gene: ENSNLEG00000007409   Transcript: ENSNLET00000009459
Sequence length 2474
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:54648141:54810632:1 gene:ENSNLEG00000007409 transcript:ENSNLET00000009459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCPSICCHSLKLLH
ITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQ
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPQEEVPFRMNYSSFLRIWVSFIFALVRNQAQPRELMYPFWQNDTKTPKV
DDGSSSEIKLAIPVFFFGVPYRSVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWA
DVHNGIRGEIYYRETMDPVILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTT
PVNTFQAVLVSDGSYTFTLFNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFS
LPGSRTPEIVNIQETTNVNVPGRWAFKVDGKEIDPANGCTSRGQFLRQGEVFWDDLNCTI
KCRCLDFNNEIYCQEASCSPYEVCELKGKFFYCSAVETSTCVVFGEPHYHTFDGFLFHFQ
GSCAYLLARQCLQTSSLPFFSVEAKNEHRGGSAVSWVKELSVEVNGYKILIPKGSYGKVK
VNDLVTSLPVTLDLGTVKIYQSGMSTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLC
GNYNKNPLDDFLRPDGRPAMSVLDLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGS
DYCGFLNKTDGPLWECGTVVDPTAFVHSCVYDLCSVRDNGTLFCQAIQAYALVCQALGIP
IGDWRTQTGCVSTVQCPSFSHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNEGFVLST
SQCVPLHKCGCDFDGHYYTMGEFFWATANCTVQCLCEEGGDVYCFNKTCGSGEVCAVEDG
YQGCFPKRETVCLLSQNQVLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDA
GPAWLRGLRILVADQEVKIGGIGASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESKG
VVTVQYSDIGLLYIRLSTTYFNCTGGLCGFYNANASDEFCLPNGKCTDNLAVFLESWTTF
EEICNGECGDLLKACNNDSELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLF
RLCQSGGNESELCDSVARYASACKNADVEVGPWRTYDFCPLECPENSHFEECITCTETCE
TLALGPICVDSCSEGCQCDEGYALLGSQCVTRSECGCNFEGHQLATNETFWVDLDCQIFC
YCNGTDNSVHCETIPCKDDEYCMEEGGLYYCQARTDASCIVSGYGHYLTFDGFPFDFQTS
CPLILCTTGSRPSSDSFPKFVVTAKNEDRDPSLALWVKQVDVTMFGYSIVIHRAYKHTVL
VNSERLYLPLKLGQGKINIFSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLC
GRYNGNPDDDLEMPMGLLASSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFAKVQQLC
SLIPNQNAAFSKCHSKVNPTFFYKNCLFDSCIDGGAVQTACNWLQNYASTCQTQGITVTG
WRNYTSCAVTCPPNSHYESCVSVCQPRCAAIRLKSDCSHYCVEGCQCDAGYVLNGKSCIL
PHSCGCYSDGKYYEPKQLFWNSDCTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFS
TKTSYCLAAGGGVFRTFDGAFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTI
ISPVYFYINEEQILINDRNTVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYN
GFNVIKISISERLQNKVCGLCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKXXX
XXXXXELQFSQYAAMCDNVHIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDG
CYNHKKFQLCGSLAAYGEACRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELGNGR
ELCGCIEPPPYGNNSHDIIDAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCTGIE
GEDFISFQINNTKGNCGNIVQSNGTHIMYKNTLWIESANNTGNIITRDRTINVEFSCAYE
LDIKISLDSVVKPMLSVINLTVPTQEGSFITKMALYKNASYKHPYRQGEVVLTTRDVLYV
GVFVVGADATHLILTLNKCYATPSRDSNDKLRYFIIEEGCQNLKDNTIGIEENAVSLTCR
FHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPQNSRIATDYTKEPKEQIISVGPIR
RKRLDWCEDNGGCEQICTSRVDGPLCSCVTGTLQEDGKSCRASNSSIELQVWTLLLIMIQ
ILLWHFVYKSGTTS
Download sequence
Identical sequences ENSNLEP00000009031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]