SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009036 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009036
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000598
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 133-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000279
Family C1 set domains (antibody constant domain-like) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009036   Gene: ENSNLEG00000007415   Transcript: ENSNLET00000009465
Sequence length 392
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:56408234:56442815:1 gene:ENSNLEG00000007415 transcript:ENSNLET00000009465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKTSLQWLTPSGFTIFLN
EYPAFKNSKYQLLHHSANQLSISVPNVTLQDEGVYKCLRYSDSVSTKEVKVIVLATPFKP
ILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLFGNGVEVSGGTHHEFETDGKKCNTTS
TLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQP
TSTVSVMEDSSTSEIDKEEKEQTTQDPALTTEANPQYLGLARKKSGILLLTLVSFLIFIL
FIIVQLFIMKLRNAHVIWKKENEVSEHTLESYRSRSNNEETSSQEKNGQSSHPMRCMNYI
TKLYSEAKTKRKENGQHSELKEKHTQVPESIV
Download sequence
Identical sequences G1R764
ENSNLEP00000009036 ENSNLEP00000009036 XP_003253347.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]