SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009043 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009043
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009043   Gene: ENSNLEG00000007423   Transcript: ENSNLET00000009473
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:57224137:57246231:-1 gene:ENSNLEG00000007423 transcript:ENSNLET00000009473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAFNRLLPPASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE
Download sequence
Identical sequences A0A2I3H6W0
ENSNLEP00000009043 XP_003253356.1.23891 ENSNLEP00000009043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]