SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009056 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009056
Domain Number 1 Region: 41-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000358
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Domain Number 2 Region: 203-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000401
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009056   Gene: ENSNLEG00000007439   Transcript: ENSNLET00000009490
Sequence length 387
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:58162362:58172708:-1 gene:ENSNLEG00000007439 transcript:ENSNLET00000009490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISLPGLLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSAQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGNSRGYSIKTLELNVLVPPAPPSRTGNGGYCTSQSAAGSQAQLSHL
SPHQGIDKPVPGLMAKLCPDVIHGSLSLTNLSSSMAGVYICKAHNEVGTAQCNVTLEVST
GPGAAVVAGAVVGTLVGLGLLAGLVILYHRRGKALEEPANDIKEDAIAPRTLPWPKNSDT
ISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPG
GVSSSGLSRMGAVPVMVPAQSQAGSLV
Download sequence
Identical sequences ENSNLEP00000009056 ENSNLEP00000009056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]