SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009060 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009060
Domain Number 1 Region: 628-812
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-25
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 203-300
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-23
Family I set domains 0.0073
Further Details:      
 
Domain Number 3 Region: 397-483
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-22
Family I set domains 0.0064
Further Details:      
 
Domain Number 4 Region: 287-388
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-22
Family I set domains 0.044
Further Details:      
 
Domain Number 5 Region: 498-602
Classification Level Classification E-value
Superfamily Fibronectin type III 6.3e-22
Family Fibronectin type III 0.0000281
Further Details:      
 
Domain Number 6 Region: 115-207
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 11-110
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-17
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009060   Gene: ENSNLEG00000007442   Transcript: ENSNLET00000009494
Sequence length 1331
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:58274531:58292765:1 gene:ENSNLEG00000007442 transcript:ENSNLET00000009494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRVGPEDAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRA
HRLLLPSGALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPG
NVVVAVGEPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSDTLKSDAGM
YVCVASNMAGERESAAAEVMVLERPSFLSRPVNQVVLADAPVNFLCEVKGDPPPRLRWRK
ENGELPTGRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQP
QDQMAAPGESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITA
VQRGDAGYYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCR
VTGNPQPSVRWKKDGQWLQGDDLQFKKMANGTLYITNVQEMDMGFYSCVAKSSIGEAMWS
GWLKMREDWGVSPDPPTEPSTPPGAPSQPVATEITKNSITLTWKPNPQTGAAVTSYVIEA
FSPAAGNTWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGVWGLSEPSPVSEPVRTQDSS
PSRPVEDPWRGQQGLAEVAVRLQEPIVLGPQTLQVSWTVDGPVQLVRGFRVSWRVAGPEG
GSWTMLDLQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEDAPSGPPQ
GVAVALGGDGNNSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLR
GLVPGLLYRTLVAAATSAGVGVPSAPLLVQLPSPPDLEPGLEAGAGLAERLARVLREPAF
LAGSGAACGALLLGLCVALYRRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMG
LGPAPYPWLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAP
GEGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWIQYAPPEWSQGDSGAKGGKVKLLGKA
VQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERGHLTEPSSSGGCL
VTPSRRETPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQP
MLGIREVRPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPPARFRKKP
KALPYRRENSPGGALSPLPTRPPLIGSSPAAPVPALHLLPELSLWSGWQGGSASCLHLAA
LPSCAAEEAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSRSQSQ
RPGQKRREEPL
Download sequence
Identical sequences ENSNLEP00000009060 ENSNLEP00000009060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]